HORDB

ID: hor002204
Uniprot ID: Q9W7R2
Protein name: Insulin A chain
Gene name: INS
Organism: Verasper moseri (Barfin flounder)
Family: Insulin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Verasper (genus), Pleuronectidae (family), Pleuronectoidei (suborder), Pleuronectiformes (order), Carangaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: GIVEQCCHKPCNIFDLQNYCN
Length: 21
Propeptide: MAALWLQSVSLLVLMLVSWSGSQAVLPPQHLCGAHLVDALYLVCGERGFFYTPKRDVDPLLGFLPAKSGGAAAGGENEVAEFAFKDQMEMMVKRGIVEQCCHKPCNIFDLQNYCN
Signal peptide: MAALWLQSVSLLVLMLVSWSGS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002204_AF2.pdb

hor002204_ESM.pdb

Mass:	279874	Formula:	C103H157N29O32S4
Absent amino acids:	AMRSTW	Common amino acids:	C
pI:	5.44	Basic residues:	2
Polar residues:	9	Hydrophobic residues:	5
Hydrophobicity:	-24.29	Boman Index:	-2904
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	69.52
Instability Index:	6896.19	Extinction Coefficient cystines:	1740
Absorbance 280nm:	87